Pfkfb4 Antibody - middle region : HRP

Pfkfb4 Antibody - middle region : HRP
Artikelnummer
AVIARP56585_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pfkfb4 is a synthesis and degradation of fructose 2,6-bisphosphate.

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: RIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 453

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56585_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56585_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 270198
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×