PFKFB4 Antibody - N-terminal region : FITC

PFKFB4 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56584_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4

Key Reference: Bobarykina,A.Y., (2006) Acta Biochim. Pol. 53 (4), 789-799

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56584_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56584_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5210
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×