PFKFB4 Antibody - N-terminal region : HRP

PFKFB4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56584_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4

Key Reference: Bobarykina,A.Y., (2006) Acta Biochim. Pol. 53 (4), 789-799

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 469

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56584_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56584_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5210
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×