PGBD2 Antibody - middle region : FITC

PGBD2 Antibody - middle region : FITC
Artikelnummer
AVIARP54445_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PiggyBac transposable element-derived protein 2

Protein Size: 341

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54445_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54445_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 267002
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×