PGBD2 Antibody - middle region : HRP

PGBD2 Antibody - middle region : HRP
Artikelnummer
AVIARP54445_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PiggyBac transposable element-derived protein 2

Protein Size: 341

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54445_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54445_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 267002
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×