PGM1 Antibody - middle region : Biotin

PGM1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56384_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. In most ce

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM1

Key Reference: Takahara,K., (2007) Am. J. Med. Sci. 334 (6), 421-425

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoglucomutase-1

Protein Size: 562

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56384_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56384_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5236
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×