PGM2L1 Antibody - N-terminal region : Biotin

PGM2L1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55658_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM2L1

Key Reference: Maliekal,P., (2007) J. Biol. Chem. 282 (44), 31844-31851

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose 1,6-bisphosphate synthase

Protein Size: 622

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55658_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55658_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283209
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×