PGM3 Antibody - middle region : Biotin

PGM3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56756_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM3

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56756_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56756_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5238
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×