PHACTR3 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3

Key Reference: Worch,S., (2006) Cytogenet. Genome Res. 115 (1), 23-29

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatase and actin regulator 3

Protein Size: 448

Purification: Affinity Purified

• Artikelnummer: AVIARP53447_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53447_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 116154
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin