PHACTR3 Antibody - C-terminal region : HRP

PHACTR3 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53447_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3

Key Reference: Worch,S., (2006) Cytogenet. Genome Res. 115 (1), 23-29

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatase and actin regulator 3

Protein Size: 448

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53447_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53447_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 116154
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×