Phactr3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatase and actin regulator 3 EMBL CAM15805.1

Protein Size: 518

Purification: Affinity Purified

• Artikelnummer: AVIARP53446_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53446_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 74189
• Wirt: Rabbit
• Konjugat: Conjugated, FITC