Phkg1 Antibody - N-terminal region : Biotin

Phkg1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56680_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56680_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56680_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29353
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×