Phkg1 Antibody - N-terminal region : FITC

Phkg1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56679_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phkg1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56679_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56679_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29353
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×