Phkg1 Antibody - N-terminal region : HRP

Phkg1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56679_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phkg1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56679_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56679_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29353
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×