PHLDA1 Antibody - middle region : Biotin

PHLDA1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54809_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1

Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology-like domain family A member 1

Protein Size: 401

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54809_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54809_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22822
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×