PHLDA3 Antibody - N-terminal region : HRP

PHLDA3 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54891_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of PHLDA3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHLDA3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin homology-like domain family A member 3

Protein Size: 127

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54891_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54891_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23612
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×