Phpt1 Antibody - C-terminal region : FITC

Phpt1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54984_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phpt1 exhibits phosphohistidine phosphatase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Phpt1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 14 kDa phosphohistidine phosphatase

Protein Size: 124

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54984_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54984_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 75454
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×