Phpt1 Antibody - C-terminal region : HRP

Phpt1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54984_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phpt1 exhibits phosphohistidine phosphatase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Phpt1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 14 kDa phosphohistidine phosphatase

Protein Size: 124

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54984_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54984_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 75454
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×