PHYH Antibody - middle region : FITC

PHYH Antibody - middle region : FITC
Artikelnummer
AVIARP56682_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have b

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHYH

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phytanoyl-CoA dioxygenase, peroxisomal

Protein Size: 338

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56682_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56682_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5264
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×