PI16 Antibody - middle region : Biotin

PI16 Antibody - middle region : Biotin
Artikelnummer
AVIARP55590_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI16

Key Reference: Reeves,J.R., Clin. Cancer Res. 12 (20 PT 1), 6018-6022 (2006)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidase inhibitor 16

Protein Size: 463

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55590_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55590_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221476
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×