PI4K2B Antibody - middle region : HRP

PI4K2B Antibody - middle region : HRP
Artikelnummer
AVIARP57204_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules. PIP itself may also have direct functional and s

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4K2B

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylinositol 4-kinase type 2-beta

Protein Size: 481

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57204_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57204_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55300
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×