PIK3R5 Antibody - middle region : FITC

PIK3R5 Antibody - middle region : FITC
Artikelnummer
AVIARP55012_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIK3R5

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: SRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 5

Protein Size: 880

Purification: Affinity Purified

Subunit: 5
Mehr Informationen
Artikelnummer AVIARP55012_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55012_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23533
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×