PIM1 Antibody - N-terminal region : FITC

PIM1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56390_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B, resulting in enhanced nuclear export and

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1

Key Reference: Wernig,G., (2008) Blood 111 (7), 3751-3759

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase pim-1

Protein Size: 404

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56390_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56390_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5292
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×