PIN4 Antibody - middle region : FITC

PIN4 Antibody - middle region : FITC
Artikelnummer
AVIARP56688_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIN4

Key Reference: Kessler,D., (er) BMC Biol. 5, 37 (2007)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Protein Size: 156

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56688_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56688_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5303
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×