PINX1 Antibody - middle region : Biotin

PINX1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57058_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and act as tumor suppressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PINX1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PIN2/TERF1-interacting telomerase inhibitor 1

Protein Size: 328

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57058_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57058_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54984
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×