PINX1 Antibody - N-terminal region : HRP

PINX1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57057_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PINX1

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PIN2/TERF1-interacting telomerase inhibitor 1

Protein Size: 328

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57057_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57057_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54984
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×