PIP4K2A Antibody - N-terminal region : FITC

PIP4K2A Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56620_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encode

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIP4K2A

Key Reference: Loughney,K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha

Protein Size: 406

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56620_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56620_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5305
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×