PITPNB Antibody - middle region : HRP

PITPNB Antibody - middle region : HRP
Artikelnummer
AVIARP54893_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes. The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PITPNB

Key Reference: Morgan,C.P., (2006) Biochem. J. 398 (3), 411-421

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: FFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphatidylinositol transfer protein beta isoform

Protein Size: 271

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54893_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54893_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23760
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×