PLA2G4E Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of human PLA2G4E

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytosolic phospholipase A2 epsilon Ensembl ENSP00000413897

Protein Size: 839

Purification: Affinity Purified

• Artikelnummer: AVIARP53548_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53548_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 123745
• Wirt: Rabbit
• Konjugat: Conjugated, HRP