PLEK Antibody - N-terminal region : FITC

PLEK Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56397_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56397_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56397_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5341
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×