PLEK Antibody - N-terminal region : HRP

PLEK Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56397_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEK

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56397_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56397_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5341
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×