PLEKHA1 Antibody - N-terminal region : FITC

PLEKHA1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57544_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA1

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology domain-containing family A member 1

Protein Size: 404

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57544_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57544_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 59338
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×