PLPP6 Antibody - N-terminal region : FITC

PLPP6 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55973_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAPDC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: phospholipid phosphatase 6

Protein Size: 295

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55973_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55973_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 403313
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×