PLPP6 Antibody - N-terminal region : HRP

PLPP6 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55974_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPAPDC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: FPLAAAGPSQSPAPPLPEEDRMDLNPSFLGIALRSLLAIDLWLSKKLGVC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: phospholipid phosphatase 6

Protein Size: 295

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55974_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55974_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 403313
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×