PLS1 Antibody - N-terminal region : FITC

PLS1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56400_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The protein encoded by this ge

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLS1

Key Reference: Chafel,M.M., (1995) Dev. Dyn. 203 (2), 141-151

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Plastin-1

Protein Size: 629

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56400_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56400_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5357
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×