PLSCR1 Antibody - N-terminal region : HRP

PLSCR1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57514_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phospholipid scramblase 1

Protein Size: 318

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57514_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57514_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5359
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×