PLSCR3 Antibody - middle region : FITC

PLSCR3 Antibody - middle region : FITC
Artikelnummer
AVIARP57395_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 3

Protein Size: 295

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57395_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57395_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57048
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×