PMM1 Antibody - N-terminal region : FITC

PMM1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56401_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1

Key Reference: Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphomannomutase 1

Protein Size: 262

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56401_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56401_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5372
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×