PMM1 Antibody - N-terminal region : HRP

PMM1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56401_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1

Key Reference: Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphomannomutase 1

Protein Size: 262

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56401_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56401_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5372
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×