PNMA3 Antibody - middle region : HRP

PNMA3 Antibody - middle region : HRP
Artikelnummer
AVIARP54946_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMA3

Key Reference: Wills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: RITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSRGSRKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Paraneoplastic antigen Ma3

Protein Size: 463

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54946_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54946_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29944
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×