PNN Antibody - N-terminal region : FITC

PNN Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56403_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNN

Key Reference: Alpatov,R., (2008) Mol. Cell. Biol. 28 (5), 1584-1595

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pinin

Protein Size: 717

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56403_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56403_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5411
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×