PNN Antibody - N-terminal region : HRP

PNN Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56403_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNN

Key Reference: Alpatov,R., (2008) Mol. Cell. Biol. 28 (5), 1584-1595

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pinin

Protein Size: 717

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56403_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56403_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5411
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×