PNOC Antibody - middle region : HRP

PNOC Antibody - middle region : HRP
Artikelnummer
AVIARP56692_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNOC

Key Reference: Williams,J.P., (2008) Anesth. Analg. 106 (3), 865-866

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Prepronociceptin

Protein Size: 176

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56692_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56692_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5368
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×