PNPLA8 Antibody - middle region : Biotin

PNPLA8 Antibody - middle region : Biotin
Artikelnummer
AVIARP56759_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNPLA8

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-independent phospholipase A2-gamma

Protein Size: 782

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56759_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56759_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50640
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×