Pnrc2 Antibody - N-terminal region : HRP

Pnrc2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57027_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 134

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57027_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57027_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 100125373
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×