POLB Antibody - middle region : FITC

POLB Antibody - middle region : FITC
Artikelnummer
AVIARP56406_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB

Key Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase beta

Protein Size: 335

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56406_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56406_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5423
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×