POLL Antibody - middle region : Biotin

POLL Antibody - middle region : Biotin
Artikelnummer
AVIARP54924_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLL

Key Reference: Picher,A.J. (2007) DNA Repair (Amst.) 6 (12), 1749-1756

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase lambda

Protein Size: 575

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54924_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54924_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27343
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×