POLM Antibody - middle region : FITC

POLM Antibody - middle region : FITC
Artikelnummer
AVIARP54928_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM

Key Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed DNA/RNA polymerase mu

Protein Size: 494

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54928_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54928_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27434
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×