POLM Antibody - middle region : HRP

POLM Antibody - middle region : HRP
Artikelnummer
AVIARP54928_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM

Key Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA-directed DNA/RNA polymerase mu

Protein Size: 494

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54928_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54928_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27434
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×