POLR2C Antibody - C-terminal region : Biotin

POLR2C Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57690_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed RNA polymerase II subunit RPB3

Protein Size: 332

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57690_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57690_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5432
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×